Bradysia coprophila: 119080984 Help Entry 119080984         CDS       T08269                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism bcoo  Bradysia coprophila Pathway bcoo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bcoo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119080984  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bcoo04121]     119080984    03400 DNA repair and recombination proteins [BR:bcoo03400]     119080984 Ubiquitin system [BR:bcoo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119080984    Cul5 complex      119080984 DNA repair and recombination proteins [BR:bcoo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119080984 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  119080984 NCBI-ProteinID:  XP_037045527 LinkDB All DBs Position X Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVKELKQMIEGILKVRPRDQQVYNKENVLMLDDKQLQD YGITMSSAKAQQPAQLGLATRLESGEFEELDLTPYSSPPDLPDVMKAAEPANGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtatttttaatgattagaaggaaaaagaccacaatctttacagatgctaaagac aatacgaccgtaaaagaactgaaacaaatgatcgaaggtattttgaaagttagaccaaga gatcaacaagtttataacaaggaaaatgttttaatgcttgacgacaaacaactgcaagat tatggaataactatgtcgtcggcgaaggcacaacaaccggcacaactaggattagcaaca agattggaatcaggcgaatttgaagaactggacttaacaccatactcctcgccgcccgat ctaccagatgtcatgaaagctgcagagccagccaatggacaggagcaggttgcataa

DBGET integrated database retrieval system