Bradysia coprophila: 119082419 Help Entry 119082419         CDS       T08269                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism bcoo  Bradysia coprophila Pathway bcoo03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:bcoo00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119082419  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcoo03036]     119082419   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bcoo04147]     119082419 Chromosome and associated proteins [BR:bcoo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119082419 Exosome [BR:bcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119082419 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_H2A_C Motif Other DBs NCBI-GeneID:  119082419 NCBI-ProteinID:  XP_037047842 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MSGRGKGGKFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKE DQNHSTSLTVGHPQRRRIEQAVLLPKKTEKKA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggtaaaggtggaaaatttccagtcggtcgtattcaccgattgttgcgt aaaggcaactatgccgaacgtgtcggtgctggtgctccagtttatttggcagctgtgatg gaatatttggctgctgaagtattggaattggctggtaacgcagcccgtgacaacaaagaa gaccagaatcattccacgtcacttacagttggccatccgcaacgacgaagaattgaacaa gcagttttgttgccgaaaaagaccgaaaagaaggcttaa

DBGET integrated database retrieval system