Bifidobacterium coryneforme: BCOR_0388 Help Entry BCOR_0388         CDS       T03236                                  Name (GenBank) Exonuclease VII, small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism bcor  Bifidobacterium coryneforme Pathway bcor03430   Mismatch repair Brite KEGG Orthology (KO) [BR:bcor00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     BCOR_0388  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bcor03400]     BCOR_0388 Enzymes [BR:bcor01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      BCOR_0388 DNA repair and recombination proteins [BR:bcor03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      BCOR_0388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S CCDC93_CC Motif Other DBs NCBI-ProteinID:  AII74407 UniProt:  A0A076JCT7 LinkDB All DBs Position complement(510436..510756) Genome browser AA seq 106 aa AA seqDB search MSESSTKQTKGKQEAPELASALTDKERETIAKLPYEQARDQLIQAVQALEAGGLDLDASM RQWEIGEALAKRAQELLGQVRAKLDAAQEEQASAGAQAGTQSNLDA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagtgaatcatccaccaagcagacgaagggcaagcaggaagcacccgagctggcttcg gccctgaccgacaaggaacgcgaaaccatcgccaagctcccctatgagcaggcccgcgac cagctcatccaggcggttcaggccctggaagccggcggactggacctggatgcctccatg cgacagtgggagattggcgaagccctggccaaacgtgcccaggaacttctgggtcaggtc cgggcaaagctcgatgccgcccaggaggagcaggccagcgccggcgcccaggcaggcacc cagtccaacctggacgcctga

DBGET integrated database retrieval system