Bradyrhizobium commune: IC761_26075
Help
Entry
IC761_26075 CDS
T09283
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
bcou
Bradyrhizobium commune
Brite
KEGG Orthology (KO) [BR:
bcou00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
IC761_26075 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Lipase_3
Motif
Other DBs
NCBI-ProteinID:
QPF89950
UniProt:
A0A7S9GYV0
LinkDB
All DBs
Position
5550463..5550768
Genome browser
AA seq
101 aa
AA seq
DB search
MNDTVTKPKTRTKIKVERPKLHKVILINDDYTPREFVTMILKAEFRMTEDQAYKVMITAH
KLGACVVAVFTKDVAETKATRATDAGRAKGYPLLFTTEPEE
NT seq
306 nt
NT seq
+upstream
nt +downstream
nt
atgaacgacaccgtcaccaagccgaagacgcggaccaagatcaaggtcgagcggccgaag
ctgcacaaggtcatcctgatcaacgacgactacacaccgcgtgagttcgtcaccatgatc
ctgaaggccgagttccgcatgaccgaggatcaggcctacaaggtcatgatcaccgctcac
aagctgggcgcctgtgtcgtcgccgtcttcaccaaggacgtcgccgagaccaaggccacc
cgcgccaccgatgccggccgcgccaagggttatccgctgttgttcacgacagagccggaa
gaatag
DBGET
integrated database retrieval system