Bradyrhizobium commune: IC761_27800 Help Entry IC761_27800       CDS       T09283                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcou  Bradyrhizobium commune Pathway bcou01100   Metabolic pathways bcou01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcou00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IC761_27800    00074 Mycolic acid biosynthesis     IC761_27800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IC761_27800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPF90273 UniProt:  A0A7S9D394 LinkDB All DBs Position complement(5923725..5923976) Genome browser AA seq 83 aa AA seqDB search MTSPQIYEKLTGIFRDVFFEDDLSISPETTADDVDGWDSLTHIRLVLEVSKAFGVNFTAS EIGSLKNVGEFAELIEKKLQAKA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacatcaccgcagatctacgaaaagctcaccggaatttttcgcgatgtctttttcgaa gacgacctttcgatctcgccggagacgacggccgacgacgtggacggctgggacagcctg acccacatccgcctggttctggaggtttccaaggcgttcggcgtcaacttcaccgcgtcc gagatcggcagcctcaagaacgttggggaattcgccgaactcatcgagaagaagctgcag gcgaaggcctag

DBGET integrated database retrieval system