Eshraghiella crossota: NQ527_06935 Help Entry NQ527_06935       CDS       T08600                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcro  Eshraghiella crossota Pathway bcro01100   Metabolic pathways bcro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQ527_06935 (acpP)    00074 Mycolic acid biosynthesis     NQ527_06935 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQ527_06935 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  UWO49681 LinkDB All DBs Position complement(1407883..1408113) Genome browser AA seq 76 aa AA seqDB search MEFEKLQQIIAEVLNVEPDEITMDTTFVDDLGADSLDVFQIIMGIEEEFDIEIPNEAAES IVTVADAVEQIKNALN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaatttgaaaagttacagcagattattgcagaggtattgaatgttgaacctgatgag attacaatggatacaacttttgtagatgatttaggtgcagattctcttgatgttttccag ataataatgggaattgaagaagaatttgatatcgaaattcctaatgaagcagcagaatca atcgttactgttgctgatgctgttgagcagattaagaatgctcttaactaa

DBGET integrated database retrieval system