Burkholderia cepacia GG4: GEM_2395 Help Entry GEM_2395          CDS       T02205                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bct  Burkholderia cepacia GG4 Pathway bct00998   Biosynthesis of various antibiotics bct01100   Metabolic pathways bct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GEM_2395    00074 Mycolic acid biosynthesis     GEM_2395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GEM_2395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AFQ48804 UniProt:  A0A9W3K0X4 LinkDB All DBs Position 1:complement(2632104..2632343) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKTEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcagaa gccgagatcaagaccgaagcttcgttcgtgaacgatctgggcgcggactcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system