Bacillus cereus AH820: BCAH820_1889 Help Entry BCAH820_1889      CDS       T00814                                  Name (GenBank) ACT domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bcu  Bacillus cereus AH820 Pathway bcu00290   Valine, leucine and isoleucine biosynthesis bcu00650   Butanoate metabolism bcu00660   C5-Branched dibasic acid metabolism bcu00770   Pantothenate and CoA biosynthesis bcu01100   Metabolic pathways bcu01110   Biosynthesis of secondary metabolites bcu01210   2-Oxocarboxylic acid metabolism bcu01230   Biosynthesis of amino acids Module bcu_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bcu_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bcu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BCAH820_1889    00660 C5-Branched dibasic acid metabolism     BCAH820_1889   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BCAH820_1889   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BCAH820_1889 Enzymes [BR:bcu01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BCAH820_1889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT Motif Other DBs NCBI-ProteinID:  ACK88533 UniProt:  B7JJG6 LinkDB All DBs Position 1789911..1790123 Genome browser AA seq 70 aa AA seqDB search MSHTFSLVIDNDPNVLLRISGIFARRGYYISSLNLNESEMELTAVCTEQEATLLVGQLKK LINVLQVNKL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttatcgataacgatccaaatgtcttattacgtataagt ggaatttttgctcggcgtggttattatatttcttcattaaatttaaatgaaagtgaaatg gagttaacggcagtttgtacagaacaagaagcaacattactcgttggtcagttgaaaaag ttaatcaatgtactacaagtaaacaaattataa

DBGET integrated database retrieval system