Bacillus cereus 03BB102: BCA_1857 Help Entry BCA_1857          CDS       T00869                                  Name (GenBank) conserved domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bcx  Bacillus cereus 03BB102 Pathway bcx00290   Valine, leucine and isoleucine biosynthesis bcx00650   Butanoate metabolism bcx00660   C5-Branched dibasic acid metabolism bcx00770   Pantothenate and CoA biosynthesis bcx01100   Metabolic pathways bcx01110   Biosynthesis of secondary metabolites bcx01210   2-Oxocarboxylic acid metabolism bcx01230   Biosynthesis of amino acids Module bcx_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bcx_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bcx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BCA_1857    00660 C5-Branched dibasic acid metabolism     BCA_1857   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BCA_1857   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BCA_1857 Enzymes [BR:bcx01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BCA_1857 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT ACT_4 Motif Other DBs NCBI-ProteinID:  ACO28255 UniProt:  A0A158RMA6 LinkDB All DBs Position 1724908..1725138 Genome browser AA seq 76 aa AA seqDB search MSHTFSLVIHNEPSVLLRISGIFARRGYYISSLHLNERDTSGVSEMKLTAVCTENEATLL VSQLKKLIDVLQVNKL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcactcgttattcataacgagccaagcgtcttattacgtataagt ggaatttttgctcggcgtggctattatatttcttctttacatttaaacgaaagagatact agtggtgtttctgaaatgaaactcacagcagtttgtactgaaaatgaagcgacattactt gttagtcagttgaaaaaattaattgatgtactgcaagtaaataaattataa

DBGET integrated database retrieval system