KEGG   Bacillus cereus 03BB102: BCA_3784
Entry
BCA_3784          CDS       T00869                                 
Name
(GenBank) phosphonate ABC transporter, ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCA_3784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcx02000]
    BCA_3784
Enzymes [BR:bcx01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     BCA_3784
Transporters [BR:bcx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    BCA_3784
SSDB
Motif
Pfam: ABC_tran RsgA_GTPase AAA_22 AAA_30 AAA_21 AAA_33 AAA_16 SMC_N AAA_18 KdpD AAA_29 nSTAND1 NB-ARC AAA_25 APS_kinase Arf MMR_HSR1 nSTAND3 AAA_19
Other DBs
NCBI-ProteinID: ACO29561
UniProt: A0A158RQA3
LinkDB
Position
complement(3539584..3540357)
AA seq 257 aa
MIEFRNVSKVYPNGTKGLNNINLKIQKGEFVVMVGLSGAGKSTLLRSVNRLHEITEGEIM
IEGESITAAKGKGLRRMRRDIGMIFQSFNLVKRSTVLKNVLAGRVGYHSTLRTTLGLFPK
EDLELAFQSLKRVNILEKAYARADELSGGQQQRVSIARALAQEAKIILADEPVASLDPLT
TKQVLDDLKKINEDFGITTIVNLHSIDLARQYATRIIGLHAGEIVFDGLVEEATDEKFAE
IYGDVAQKSELLEVAVK
NT seq 774 nt   +upstreamnt  +downstreamnt
gtgatagagtttcgaaatgtgtccaaagtgtatccaaatggtacaaaaggattgaataat
ataaacttgaaaattcaaaaaggtgagtttgttgtaatggtagggttgtccggagctgga
aagtctacacttctaagatcggtaaatcgtcttcatgagattacagaaggagaaatcatg
attgaaggtgagtctattacggctgcgaaaggaaaaggattacgccgcatgcgccgggat
attggtatgatttttcaaagttttaaccttgtaaagcgatcaacagtattaaagaacgta
ttagctggccgtgttgggtatcattcgacgttgcgtacaacgttaggcctatttccgaaa
gaagatttggagcttgcttttcaatcgttaaaaagagtaaatattttagaaaaagcatat
gcgcgtgctgatgaattatcaggaggacaacagcaacgtgtatcgattgctagagcgttg
gcgcaagaagcaaaaatcatattggcagatgaacctgttgcatcgttagatccgctaaca
acaaagcaagtattagatgatttgaagaaaattaatgaagattttggaattacaacaatt
gtaaacttacattctattgatttagctaggcaatatgcgacgcgcattattggattacat
gcaggagaaattgtttttgatggcttagtagaagaggcaacggatgaaaagtttgctgaa
atttatggtgacgtagcacagaaaagtgaattgttagaggtggcagttaaatga

DBGET integrated database retrieval system