KEGG   Bacillus dafuensis: FSZ17_08160
Entry
FSZ17_08160       CDS       T06982                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bda  Bacillus dafuensis
Brite
KEGG Orthology (KO) [BR:bda00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bda03000]
    FSZ17_08160
Transcription factors [BR:bda03000]
 Prokaryotic type
  Other transcription factors
   Others
    FSZ17_08160
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QED47225
UniProt: A0A5B8Z2H6
LinkDB
Position
1724048..1725007
AA seq 319 aa
MQKLFAQFGILLLSLLLLTSCGQAMSSGNLKKAGLLIPDTINDQVWGTKGYKGMLKIQSH
HNIDVYYKEGMNSQLVVERAVKEFDQKGVNIIFGHGNEYAEYFNEISPKYPNIHFVSFNG
NAENSNTTSLNFEAYAMGFFGGMIAGHMTKTDTVGIIAAYEWQPEIEGFYEGANFENKDV
NVIIEYVGNWDNDKKAIELLDKVFAKGVDVVYPAGDGYNVPVIEKVKEEGHYAIGYISDQ
SDLGESAVLTSTVQHVDVLYELVADMFDKGELKSGNLSFDFQDDVITLGKFSSDVDQEFI
DKINKAIEDYKKTGKLPNE
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcaaaaattatttgcacaatttgggattcttcttttaagccttcttttattgacctcc
tgtggacaagcaatgtcctcaggtaatcttaagaaagcaggcttactaatccctgatact
ataaatgatcaagtgtggggaacgaagggctataaaggaatgttaaagattcaatcccac
cataatatagatgtatattataaagagggcatgaattcacaattggttgtggaacgtgct
gttaaagaatttgaccaaaagggtgttaacatcattttcggtcatggaaatgaatatgcg
gaatattttaatgaaatatctccaaagtatccaaatattcattttgttagcttcaacgga
aatgctgaaaactcgaatacaacaagtttaaattttgaagcatatgcaatgggctttttt
ggcggaatgatcgctggacatatgacaaaaacagataccgttggaatcattgctgcttat
gagtggcagccagaaatcgaaggcttttatgaaggggcaaattttgagaacaaagacgtt
aatgtcataattgaatatgtcggaaattgggataatgataaaaaggcaattgaacttttg
gataaagtatttgcaaaaggtgtggatgttgtttaccctgcaggggatggctataatgtt
cccgtaattgaaaaggtcaaagaagaaggacactatgccattgggtatatatcagaccaa
tcagatcttggagaatctgctgtattgacaagtacggttcagcatgtggatgttctatat
gaattagtggcagatatgtttgataaaggggaactaaaatccggaaatctttcattcgat
tttcaagatgatgtcatcactttagggaaatttagttctgacgtggatcaagagtttatt
gataaaataaataaagcaattgaagactataaaaaaacgggaaaactacctaacgaataa

DBGET integrated database retrieval system