Bdellovibrio sp. NC01: DOE51_09535 Help Entry DOE51_09535       CDS       T06360                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdc  Bdellovibrio sp. NC01 Pathway bdc01100   Metabolic pathways bdc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DOE51_09535    00074 Mycolic acid biosynthesis     DOE51_09535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DOE51_09535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QDK37809 UniProt:  A0A514WWC7 LinkDB All DBs Position complement(1966227..1966463) Genome browser AA seq 78 aa AA seqDB search MALHPKVKDIIVEQLGVDPEKVKPEASFIDDLGADSLDIVELVMAMEEEFDLEIPDEDAE KLKTVQDVASYLEKKGKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcattgcatccaaaagtgaaagacatcatcgtagaacaacttggcgtagatccagag aaagttaagcctgaagcttctttcatcgacgatctaggtgcagacagccttgatatcgtt gaactagtaatggctatggaagaagaattcgatcttgaaattccagacgaagacgctgaa aagcttaaaactgttcaagacgttgcttcttacctagagaaaaaaggtaaagcgtag

DBGET integrated database retrieval system