Burkholderia diffusa: WI26_19635 Help Entry WI26_19635        CDS       T04698                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism bdf  Burkholderia diffusa Brite KEGG Orthology (KO) [BR:bdf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bdf03036]     WI26_19635    03400 DNA repair and recombination proteins [BR:bdf03400]     WI26_19635 Chromosome and associated proteins [BR:bdf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WI26_19635 DNA repair and recombination proteins [BR:bdf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WI26_19635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS YL1_C INTS7_N Motif Other DBs NCBI-ProteinID:  AOI59841 UniProt:  A0AAW3PEB2 LinkDB All DBs Position 2:complement(943411..943698) Genome browser AA seq 95 aa AA seqDB search MQLQKLQAELAQLDRRIRAARRGERQAALVQVRQLVTSYALTAREVFGQGYSDRAKLFTV GAKYRDPATGATWSGRGRAPVWIAGRDRAAFLIRE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcaactgcagaaactgcaagcggagctcgcgcaactcgatcgacgcatccgggcggcg cgccgcggcgaacgccaggccgcactggtgcaggtgcgccagctcgtgacgagctatgcg ctgaccgcgcgagaagtcttcgggcagggttacagcgatcgcgcgaagctgttcacggtc ggcgcgaaatatcgcgacccggcgacgggcgccacctggagcgggcgcggtcgcgcgcct gtctggatcgccggccgcgaccgcgccgcgttcctgatccgggaatga

DBGET integrated database retrieval system