Phocaeicola dorei HS1_L_3_B_079: GV66_21520 Help Entry GV66_21520        CDS       T03263                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdh  Phocaeicola dorei HS1_L_3_B_079 Pathway bdh01100   Metabolic pathways bdh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GV66_21520    00074 Mycolic acid biosynthesis     GV66_21520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GV66_21520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AII70081 UniProt:  A0A4V6P7N6 LinkDB All DBs Position complement(5066131..5066355) Genome browser AA seq 74 aa AA seqDB search MKEKVLEIVNEIRVAKELSAITQLHAEDNLRDDLEFTSFDLAELTVRIEDEFDIDIFEDG LVNTIGEVYSKLQK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaagaaaaagtattggaaatagtaaatgaaatcagggtggcaaaagaattgtctgcc ataacccaacttcatgccgaagacaatcttcgtgatgacttggaattcacatcattcgat ctggcagaactgacagttcgaattgaggatgaatttgacattgatatttttgaggatggt ttggtaaatactatcggtgaagtttactcaaaacttcaaaagtaa

DBGET integrated database retrieval system