Brachypodium distachyon (stiff brome): 100823371 Help Entry 100823371         CDS       T01717                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi04016   MAPK signaling pathway - plant bdi04070   Phosphatidylinositol signaling system bdi04075   Plant hormone signal transduction bdi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:bdi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100823371    04070 Phosphatidylinositol signaling system     100823371    04075 Plant hormone signal transduction     100823371  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100823371  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bdi01009]     100823371   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bdi04131]     100823371    03036 Chromosome and associated proteins [BR:bdi03036]     100823371   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bdi04147]     100823371 Protein phosphatases and associated proteins [BR:bdi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100823371 Membrane trafficking [BR:bdi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100823371 Chromosome and associated proteins [BR:bdi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100823371 Exosome [BR:bdi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100823371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  100823371 NCBI-ProteinID:  XP_003566831 UniProt:  I1HEB0 LinkDB All DBs Position 2:complement(8199713..8203326) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctattc gacaaggacggagacggctgcatcaccaccaaggaacttggaactgtgatgcgctcgctg gggcagaacccaactgaggctgagcttcaggatatgatcaatgaagtggatgctgatggc aacggaacgatcgactttccagagttcctcaacctgatggcgcgtaagatgaaggacact gattctgaggaggagcttaaggaggctttccgtgtgtttgataaggaccagaatggcttc atctctgcggctgaactccgtcatgtcatgaccaaccttggtgagaagctgacagatgag gaggtggatgagatgatccgtgaagccgacgttgatggtgacggtcagatcaattatgaa gagttcgtgaaggtgatgatggccaagtga

DBGET integrated database retrieval system