Brachypodium distachyon (stiff brome): 100825845 Help Entry 100825845         CDS       T01717                                  Name (RefSeq) sm-like protein LSM1B   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi03018   RNA degradation Brite KEGG Orthology (KO) [BR:bdi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     100825845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bdi03019]     100825845 Messenger RNA biogenesis [BR:bdi03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      100825845   mRNA degradation factors    5'-3' decay     Lsm complex      100825845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq Motif Other DBs NCBI-GeneID:  100825845 NCBI-ProteinID:  XP_003575180 UniProt:  I1IAP4 LinkDB All DBs Position 3:47892699..47895196 Genome browser AA seq 128 aa AA seqDB search MSWAGPEELFLSTSLAGFLDKKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGEL YCDVPLGLYVIRGENVVLIGELDREKDELPAHMTCVSEAEIRRAEKAEREARDLKGSMRK RMEFLDFD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcttgggccggcccggaggagctcttcctctccacctccctcgccggctttttggac aagaaacttatagttctactacgagatggaaggaaactgctcggcaccctgtgttccttt gatcagtttgcaaacgttgttctccaaggtgcttgtgaacgagtaatcgttggggaactg tattgcgatgttcctcttggtctttacgtcatccgtggagagaatgttgttttaatcggt gaattggaccgcgagaaggatgaactccctgctcacatgacctgtgtttcagaggcagaa ataagaagggctgagaaagcggaaagagaagcaagagatcttaagggctcaatgaggaaa cggatggagttcctagactttgattag

DBGET integrated database retrieval system