Brachypodium distachyon (stiff brome): 100827592 Help Entry 100827592         CDS       T01717                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi03030   DNA replication bdi03410   Base excision repair bdi03420   Nucleotide excision repair bdi03430   Mismatch repair bdi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bdi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100827592    03410 Base excision repair     100827592    03420 Nucleotide excision repair     100827592    03430 Mismatch repair     100827592    03440 Homologous recombination     100827592  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bdi03032]     100827592    03400 DNA repair and recombination proteins [BR:bdi03400]     100827592 DNA replication proteins [BR:bdi03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     100827592 DNA repair and recombination proteins [BR:bdi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       100827592    MMR (mismatch excision repair)     DNA polymerase delta complex      100827592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  100827592 NCBI-ProteinID:  XP_003573434 UniProt:  I1I197 LinkDB All DBs Position 3:complement(14239758..14240746) Genome browser AA seq 122 aa AA seqDB search MRSSDGDVKSFFRQQKAHSGAAAAIKPTGGVSKKAAGNHQKTPAAALLHLTPDHCDVADA RKEAEEERRERAACEFDMDMRYGPCLGLTRAQRWRRAAALGLAPPPAALCPDDQPCLWEG RV NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaggagcagcgacggcgacgtcaagtccttcttccggcagcagaaggcccactccggc gcggcggcggccatcaagcccaccggcggcgtctccaagaaggcggcgggcaaccaccag aagacaccggctgcggctcttctccatctgaccccagatcactgcgacgtcgctgacgcg aggaaggaggcggaggaggagcgccgggagagggcggcctgcgagttcgacatggacatg cgctacgggccctgcctcggcctcacccgcgcccagcgctggcgccgcgccgcagcgctc ggcctcgccccgccgccggccgcgctctgccccgacgaccagccctgcctctgggagggc cgcgtctag

DBGET integrated database retrieval system