KEGG   Brachypodium distachyon (stiff brome): 100829370
Entry
100829370         CDS       T01717                                 
Name
(RefSeq) hemK methyltransferase family member 2
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
bdi  Brachypodium distachyon (stiff brome)
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bdi03012]
    100829370
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     100829370
Translation factors [BR:bdi03012]
 Eukaryotic type
  Release factors
   100829370
SSDB
Motif
Pfam: MTS Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_36 PrmA Methyltransf_32 CheR Methyltransf_18 Methyltransf_11 RMNT_CmcI Methyltransf_24 Methyltransf_33 PCMT rRNA_methylase Methyltransf_23 UPF0020 FmrO AviRa Cons_hypoth95 BpsA_C Methyltransf_4
Other DBs
NCBI-GeneID: 100829370
NCBI-ProteinID: XP_003563460
UniProt: I1GLG0
LinkDB
Position
1:complement(2274686..2277772)
AA seq 288 aa
MSAGDSAAVSAVEGKLAEVSTNSDLKSLPKRGKAASGRTLNTAQIQLVARHPEVYEPCDD
SFALVDALLSDKAQLLALQPSLCLEVGCGSGYVVTSLAIMLRQLGSGTHYLATDINQHAV
ETTQATLEAHGIHADVIATDIVSGLEKRLAGMVDVVVVNPPYVPTPEEEIGIKGIASSWA
GGLNGRQVIDRILPAVRELLSERGCMYMIALEDNDPLGICHLMNEKGYASRVLLKRCTEE
ESLYVLKFWQDPTAGSSASPSAKSPGSESSWISQLPFRSFWQKNNSSS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtcggctggcgacagcgcggcggtgtcggccgtggaggggaagctcgcggaggtctct
accaacagcgacttgaagagtctccccaagaggggcaaggctgcatcagggaggacacta
aacactgcccagattcagcttgtcgcaaggcatccggaggtttatgaaccatgtgatgat
tcctttgcccttgttgatgcgctgctctctgacaaagctcaacttctggcactacagccg
agtttatgccttgaggtaggatgtggcagtggttatgtcgtcacatctctggccatcatg
ctcaggcaattaggctctggaacccactacttagcaacagatatcaaccaacatgctgtg
gagacaactcaagcaacacttgaagcacatggcattcatgcagatgttattgcaactgat
attgtgtcaggtcttgagaaacgtctggctggtatggttgatgtggttgttgtgaaccct
ccttatgtgccaacacctgaggaagaaatcgggatcaagggcattgcttcatcttgggct
ggagggctgaatgggcgccaagtgattgaccgaattcttcctgctgtgcgcgagctgcta
tcagaaagagggtgtatgtacatgattgcccttgaagataatgatcctttgggtatatgc
catttgatgaatgagaaggggtatgcatcgcgtgttctcttgaagagatgtactgaagag
gagagcctttatgttctcaagttttggcaagaccccactgctggctcaagtgcttctcca
tccgctaaatctccaggcagcgagtcctcatggatttctcagttgcctttcagatccttt
tggcaaaagaataatagcagttcttga

DBGET integrated database retrieval system