Brachypodium distachyon (stiff brome): 100832741 Help Entry 100832741         CDS       T01717                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi04136   Autophagy - other Brite KEGG Orthology (KO) [BR:bdi00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     100832741  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bdi04131]     100832741    04121 Ubiquitin system [BR:bdi04121]     100832741    03029 Mitochondrial biogenesis [BR:bdi03029]     100832741 Membrane trafficking [BR:bdi04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     100832741 Ubiquitin system [BR:bdi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100832741 Mitochondrial biogenesis [BR:bdi03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100832741 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  100832741 NCBI-ProteinID:  XP_010227883 UniProt:  I1H001 LinkDB All DBs Position 1:complement(45105632..45107571) Genome browser AA seq 89 aa AA seqDB search MAAEPNQKKVVVNFQSVANAPKLRQSKFKIGGNEKFAKVIEFLRCQIHQDTVFLYVNSVF SPNPDELINDLYSGRSNALITFMFPAILS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccgccgagcccaaccagaagaaagtcgtggtgaacttccagtcggtcgccaacgcg ccgaagctgcggcagtccaagttcaagattggtggaaatgagaaattcgcaaaggtaatt gagtttcttcgctgccaaattcaccaggacacagtgtttctctacgtgaacagtgtattt tcaccgaatccagatgagttgataaatgatttgtacagtggaagatccaatgctcttatt acttttatgttccctgcaatattatcatga

DBGET integrated database retrieval system