Brachypodium distachyon (stiff brome): 100835472 Help Entry 100835472         CDS       T01717                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi04016   MAPK signaling pathway - plant bdi04070   Phosphatidylinositol signaling system bdi04075   Plant hormone signal transduction bdi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:bdi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100835472    04070 Phosphatidylinositol signaling system     100835472    04075 Plant hormone signal transduction     100835472  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100835472  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bdi01009]     100835472   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bdi04131]     100835472    03036 Chromosome and associated proteins [BR:bdi03036]     100835472   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bdi04147]     100835472 Protein phosphatases and associated proteins [BR:bdi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100835472 Membrane trafficking [BR:bdi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100835472 Chromosome and associated proteins [BR:bdi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100835472 Exosome [BR:bdi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100835472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 DUF5580_M MTIP_N SUB1_ProdP9 TerB PA_Ig-like RNA_pol_Rpb4 DUF5580 Motif Other DBs NCBI-GeneID:  100835472 NCBI-ProteinID:  XP_003559804 UniProt:  I1GNF7 LinkDB All DBs Position 1:complement(6383380..6385592) Genome browser AA seq 154 aa AA seqDB search MEGLTGEQMVAFKEAFSLFDKNGDGCISLEELAAVTRSLGLEPTEQELSDMMREVDTDGN GTIDFQEFLSLIARKMKDGDGDEELKEAFEVLDKDQNGFISPVELRTVMINLGEKMTDEE VEQMIREADTDGDGLVNYDEFVLMMKNAERKISG NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggaagggctgacgggcgagcagatggtggcgttcaaggaggccttctcgctcttcgac aagaacggcgatggatgcatcagcttggaagagttggctgcggtgacccgctcccttggc cttgagccgaccgagcaggagctcagtgacatgatgcgtgaggttgacacggatgggaac ggcaccatagacttccaggagttcttgagccttattgccaggaagatgaaggatggagac ggcgatgaagagctgaaggaagctttcgaggtcctagacaaggaccagaacggttttatc tcccctgttgagctaaggacggtgatgatcaatctcggggagaagatgaccgacgaggag gtcgagcagatgatcagggaggcggatactgacggtgatgggctggtgaactacgatgaa tttgtgctcatgatgaaaaatgctgaacgcaagatatctggctga

DBGET integrated database retrieval system