Brachypodium distachyon (stiff brome): 100838298 Help Entry 100838298         CDS       T01717                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi04145   Phagosome bdi04148   Efferocytosis bdi04620   Toll-like receptor signaling pathway bdi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bdi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100838298    04148 Efferocytosis     100838298  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100838298  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100838298  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bdi04131]     100838298   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bdi04147]     100838298    04031 GTP-binding proteins [BR:bdi04031]     100838298 Membrane trafficking [BR:bdi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100838298  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100838298   Macropinocytosis    Ras GTPases     100838298  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100838298 Exosome [BR:bdi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100838298   Exosomal proteins of other body fluids (saliva and urine)    100838298   Exosomal proteins of colorectal cancer cells    100838298   Exosomal proteins of bladder cancer cells    100838298 GTP-binding proteins [BR:bdi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100838298 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  100838298 NCBI-ProteinID:  XP_003570746 UniProt:  I1IFV3 LinkDB All DBs Position 3:59423826..59426800 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWLPELRHYSPGVPIILVGTKL DLREDKQFFIDHPGAVPISTAQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQKKKRRKAQKGCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcatcaagtgcgtcacggtgggggacggcgcggtgggcaagacc tgcctgctcatctcctacacctccaacaccttccccacggattacgttccgactgttttc gataacttcagtgctaacgttgtggtcgacgggagcaccgtcaacttgggcctgtgggat acagcaggacaggaagactataatagactgcgcccactaagctatcgtggcgctgatgta tttctgctggccttttctcttatcagcaaagcaagctatgagaatgtttctaaaaagtgg ctgcctgaattaaggcactattcccctggtgtgcccataattcttgttgggacaaagctt gatctgcgggaagacaagcagtttttcatagatcaccctggtgcggttcctatttccact gctcagggtgaggagctgaagaaggtaattggtgccacagcctacatcgagtgcagctcg aaaacacagcagaacattaaggcagtgttcgatgcggcgattaaggtggtcctccagcct ccaaagcaaaagaagaagaggcggaaggcccagaaaggatgcaccattctgtaa

DBGET integrated database retrieval system