Brachypodium distachyon (stiff brome): 100842883 Help Entry 100842883         CDS       T01717                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism bdi  Brachypodium distachyon (stiff brome) Brite KEGG Orthology (KO) [BR:bdi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:bdi03041]     100842883   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bdi04052]     100842883 Spliceosome [BR:bdi03041]  Complex B   Other components    Complex B specific factors     100842883 Cytokines and neuropeptides [BR:bdi04052]  Neuropeptides   Unclassified    100842883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL DUF5343 Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  100842883 NCBI-ProteinID:  XP_003575408 UniProt:  I1IBS6 LinkDB All DBs Position 3:complement(50463347..50464043) Genome browser AA seq 73 aa AA seqDB search MIELVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTTYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgagctggtgctgaacgaccgcctggggaagaaggtgcgcgtcaagtgcaacgag gacgacacgatcggcgacctgaagaagctggtggcggcgcagacggggacgcgcgccgac aagatccgcatccagaagtggtacaccacctacaaggaccacatcacgctcgccgactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system