Brachypodium distachyon (stiff brome): 100843942 Help Entry 100843942         CDS       T01717                                  Name (RefSeq) 10 kDa chaperonin, mitochondrial   KO K04078   chaperonin GroES Organism bdi  Brachypodium distachyon (stiff brome) Brite KEGG Orthology (KO) [BR:bdi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bdi03110]     100843942    03029 Mitochondrial biogenesis [BR:bdi03029]     100843942 Chaperones and folding catalysts [BR:bdi03110]  Heat shock proteins   HSP10    100843942 Mitochondrial biogenesis [BR:bdi03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     100843942 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  100843942 NCBI-ProteinID:  XP_003562579 UniProt:  I1GRU5 LinkDB All DBs Position 1 Genome browser AA seq 100 aa AA seqDB search MAAMKRLIPSFNRVLVEKVLQPKKSAGGILLPETSKQLNSGKVVAVGPGDRDKDGKLIPV GFKEGDHVLLPEYGGLEVKLGAEKEYLLFRENDILGTLHE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcggcgatgaagcgtctgatcccgtcgttcaaccgggtgctggtggagaaggtgctg cagcccaagaagagcgccggcggcatcctcctccctgagacctccaagcagctgaactct ggcaaagtcgtggctgttgggcctggtgaccgcgataaggatggcaagctgatccctgtt ggtttcaaggaaggtgaccatgttctcctgcctgagtatggaggacttgaagtcaagctt ggtgctgagaaagagtacctcctcttcagagagaatgacatactgggtaccctccatgag tga

DBGET integrated database retrieval system