Bdellovibrio sp. KM01: HW988_00595
Help
Entry
HW988_00595 CDS
T08445
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bdk
Bdellovibrio sp. KM01
Pathway
bdk02020
Two-component system
bdk02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
bdk00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
HW988_00595
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
HW988_00595
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bdk02022
]
HW988_00595
02035 Bacterial motility proteins [BR:
bdk02035
]
HW988_00595
Two-component system [BR:
bdk02022
]
CheA family
CheA-CheYBV (chemotaxis)
HW988_00595
Bacterial motility proteins [BR:
bdk02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
HW988_00595
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
CAF1
Aldolase
AmiR_N
Motif
Other DBs
NCBI-ProteinID:
QLY25587
LinkDB
All DBs
Position
123721..124113
Genome browser
AA seq
130 aa
AA seq
DB search
MKIRFTVIDDAAFLRELIKNIMSSAGHICVGEAENGNDGIRLVSSVLPDLVFLDMVMPLR
NGLESARAIKESHPDIMIIGCSTIDSDAMIEKAHEAGFDAYITKPFTKENLLMVVSKVLP
QAGESTHGRT
NT seq
393 nt
NT seq
+upstream
nt +downstream
nt
atgaagatacgtttcactgttatcgatgatgccgcatttctgcgcgagctgattaaaaat
ataatgagctctgctggtcatatctgtgtgggtgaagcagaaaatggaaacgatggtatt
cgcctggtttcttctgttctgcccgatcttgtattcttagacatggtgatgccgttacgt
aatggcttagagtcggctcgtgcgatcaaagaatctcatcctgacattatgatcattggt
tgttcgacaattgatagcgacgccatgattgaaaaagcgcacgaagctggctttgatgca
tatatcaccaagccgtttaccaaagaaaatttattgatggtcgtttcaaaagtgctaccg
caggcgggagaatcaactcatggaagaacttaa
DBGET
integrated database retrieval system