Bdellovibrio sp. KM01: HW988_09565 Help Entry HW988_09565       CDS       T08445                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdk  Bdellovibrio sp. KM01 Pathway bdk01100   Metabolic pathways bdk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HW988_09565 (acpP)    00074 Mycolic acid biosynthesis     HW988_09565 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HW988_09565 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QLY27206 LinkDB All DBs Position 1954155..1954391 Genome browser AA seq 78 aa AA seqDB search MALHPKVKDIIVEQLGVDPDKVKPEASFIDDLGADSLDIVELVMAMEEEFDLEIPDEDAE KLKTVQDVASYLEKKGKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcattgcatccaaaagttaaagacatcatcgtagaacaacttggcgtagatccagat aaagttaagcctgaggcttcttttatcgacgatcttggtgcagacagcttggatatcgtt gagctagtaatggctatggaagaagaattcgatcttgaaattccagacgaagacgctgaa aagcttaaaacagttcaagacgttgcttcttacctagaaaaaaaaggtaaagcgtag

DBGET integrated database retrieval system