Bdellovibrio sp. KM01: HW988_13290 Help Entry HW988_13290       CDS       T08445                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdk  Bdellovibrio sp. KM01 Pathway bdk01100   Metabolic pathways bdk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HW988_13290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HW988_13290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  QLY24428 UniProt:  A0A7H9MJI5 LinkDB All DBs Position 2728830..2729093 Genome browser AA seq 87 aa AA seqDB search MSHYSTQVVDIVNNILHEKFEVPKDALVPTANLKEDLQLDSLDFVDMFILLEQETGKNPQ NVDFMKIKNLGDIYQLVSELTVQETVN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgagccattacagcacgcaagtcgtagacatcgttaacaacattcttcatgaaaaattt gaagtgcctaaagacgcattggttcccacagcgaatcttaaagaagatctacaattggac agcttggatttcgtagacatgtttattttgctagaacaagaaaccgggaaaaatccacag aacgtggactttatgaaaatcaaaaacttgggcgatatctatcaattggtgagcgaactt acagttcaagaaactgtaaactaa

DBGET integrated database retrieval system