Burkholderia dolosa: AK34_2905 Help Entry AK34_2905         CDS       T03793                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bdl  Burkholderia dolosa Brite KEGG Orthology (KO) [BR:bdl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bdl03036]     AK34_2905    03400 DNA repair and recombination proteins [BR:bdl03400]     AK34_2905 Chromosome and associated proteins [BR:bdl03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AK34_2905 DNA repair and recombination proteins [BR:bdl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AK34_2905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS MscS_porin Histone_HNS_N HalX Motif Other DBs NCBI-ProteinID:  AJY13686 LinkDB All DBs Position 1:complement(3110632..3110928) Genome browser AA seq 98 aa AA seqDB search MSQYAKLKAQIADLQAQADEVRRQEVATVIAEVQRMIAEYGLTAQDLGFAERARRGRPPK KAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaactcaaggcccagatcgccgatctgcaggcccaggcggacgaa gtccgccgccaggaagtggcaacggtcattgccgaagttcagcggatgatcgcggaatac gggctcacggcccaggatctcggctttgcggagcgcgcgcggcgcggccgtccgccgaaa aaggcgccgctgccgccgaaataccgcgatccgaagtcgggtgcaacctggagcggccgc ggcaaaccgccgaactggatcgtcggcaaaaaccgcgatcgtttcctgatcgaatga

DBGET integrated database retrieval system