Burkholderia dolosa: AK34_5576
Help
Entry
AK34_5576 CDS
T03793
Name
(GenBank) his Kinase A domain protein
KO
K07677
two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:
2.7.13.3
]
Organism
bdl
Burkholderia dolosa
Pathway
bdl02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
bdl00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
AK34_5576
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
bdl01001
]
AK34_5576
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bdl02022
]
AK34_5576
Enzymes [BR:
bdl01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
AK34_5576
Protein kinases [BR:
bdl01001
]
Histidine kinases
NarL family
AK34_5576
Two-component system [BR:
bdl02022
]
NarL family
RcsC-RcsD-RcsB (capsule synthesis)
AK34_5576
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HATPase_c
Response_reg
HisKA
Hpt
Nitrate_red_gam
HATPase_c_2
Motif
Other DBs
NCBI-ProteinID:
AJY11346
LinkDB
All DBs
Position
3:632078..635140
Genome browser
AA seq
1020 aa
AA seq
DB search
MQLFVRGPARRLRLRLSRRREFDPQWMRAYQRALVYVGGIVLGVFMVLCGAAVAWLEIAD
YQAAMRAHFLSSRALVLVGMAENSVLLRRLVSASDTAWDPDGRASKPVEDAFLAQQGYLR
YEEPGTHHTYAATAVVDADHPVTDYRPLLALSERLLASAMWRDRAQLAPSQVYVIGASGR
YMAVSLYAMSGIGPPLERYRNLLTALPHEWPDVMALVRDADANPAAAPADIVWLPPRFDP
VSGQLVLRLAHWTFDQRQRPVALIVQTMRPSRFLNGILDADNGEFAVVDHEQRVLLTPSG
NRSDDVMSAVRAPGEPGARHATAVTQQFHDGRYVVRGPLPHTQWDVLFVYTRGMLLRAMA
PRLIGIAAGTLFGVALLVGAIVLVTRRVLDPSYLRATRLVDSERLNRTLIRTAPVGLALI
AESTGAVLLRNEIMVRHDGGAEHALSRRIWQSLAGAPDANPTLRKRLIGSREITLPAGGE
RTTDTHLLVNLVRVKYGGESALLCTVVDITARKLTEQSLDAARRAADQANRAKSVFLATM
SHEIRTPLNAVIGNLELMKRGPLADAQRRRLHAADTSSTALLHILNDVLDLSKVEAGQLR
IDAVPFDCAALLDDVTESFRPLAERKGLSVICDVALEPSPYRIGDPIRIRQIVSNLLSNA
IKFTDAGHVRVAAHAASDAAHGTGRTAGGAPVVEIVVADTGIGIPEAAQAAIFGLYRQAD
DSIHRRYGGTGLGLALCRRLLDAMSGDIAVSSAPGAGSTFRVRIPLPVCDDERGDASAEV
SDVSHVAIAGTGLSVLVVEDHPASRLLLADQLRELDVDATLVECGADALAAVERARFDIV
LTDLGLPDMDGWSLASELRARDPALRLIAMTAHVGSDDERRCADAGIHALLRKPLTLRKL
SHALGRAADTQAGGHRPSSGLPQTVLFAMRQVTHASIASIDRAVTTGDGDTVQRELHSMS
GGFVAVGQHVLGELCSGLQQVVHDEGLQGFSVLWPSLRDEITNAIAAICKVDVRARDVSV
NT seq
3063 nt
NT seq
+upstream
nt +downstream
nt
atgcaattgttcgtgagaggaccggcaagacggctgcggctccgactgtcgcgacggcgc
gagttcgacccgcagtggatgcgcgcatatcagcgcgcgctcgtgtatgtcggcggcatc
gtgctcggcgtgttcatggtgttgtgcggcgcggcggtcgcgtggctcgagattgccgac
taccaggctgcgatgcgtgcgcattttctgagcagcagggcgctcgttctggtcgggatg
gcggagaacagcgtgctgctgcgacgcctggtgtcggcgtccgatacggcatgggatccg
gacgggcgtgcatcgaagccggtcgaggatgcgttcctcgcgcagcaaggttatctgcgc
tacgaagaaccgggcacccatcatacgtacgcggcgacagcggtcgtcgatgccgatcat
cccgtgaccgattaccgaccgctgcttgcgctgagcgagcggctgctggcatccgcgatg
tggcgcgatcgcgcgcagctggcaccgagccaggtctatgtgatcggtgcgagcggtcga
tatatggcggtctcgctgtacgcgatgtcgggcatcggaccgccgctcgagcgctatcga
aatctgctgaccgcgctgccgcacgaatggccggacgtgatggcgctcgtgcgggacgcc
gacgcgaatcccgctgccgcgcccgccgacatcgtatggttgccgccgcgcttcgatccg
gtttccggccagctggtgctgcgtcttgcgcactggacgttcgatcaacggcaacggccg
gtcgcattgatcgtgcagacgatgcggccgtcgcgtttcctgaacggcatcctcgacgcg
gacaacggcgaattcgcggtagtcgatcatgagcagcgcgtgctgctgacaccgagcggc
aatcgcagcgacgacgtgatgagcgcggtgcgcgcgccgggcgagccgggcgcgcgtcac
gcgacagccgtcacgcagcagttccacgacggccggtacgtcgttcgcggcccgcttccg
catacacagtgggacgtactgttcgtctatacgcgcggcatgttgctgcgcgcgatggcg
ccgcggctgatcggcatcgctgccggcacgttgttcggcgtcgcgttgctggtcggcgcg
atcgtgctcgtcacgcggcgggtgctcgatccgtcctatctgcgcgcgacgcgtctggtc
gacagcgagcgcttgaaccgcacgttgattcgtaccgcgccggtcggtcttgcgctgatc
gccgaatcgaccggcgcggtgttgctgcgaaacgagatcatggttcgtcatgacggcggt
gccgagcacgcgttgtcgcgccggatctggcaatcgctcgccggcgcgcccgatgcgaat
ccaacgctacgcaagcggctgatcggcagccgtgagatcacgctgccggccggcggcgag
cgtacgaccgatacgcatctgctcgtcaatctcgtccgcgtcaaatatggcggcgagagt
gcgctgctttgcacggtcgtcgacatcaccgcgcgcaagctgaccgagcagtcgctcgac
gcagcgcgtcgcgcagccgaccaggcgaaccgcgcgaagtcggtgttcctggcgacgatg
agtcacgagattcgcacgccgctgaacgcggtgatcggcaacctcgaattgatgaagcgc
ggtccgcttgccgacgcgcagcgccggcgcttgcatgcggccgatacgtcgtctaccgcg
ctgttgcatatcctcaacgacgtgctcgacctgtcgaaggtcgaagcagggcagttgcgc
atcgatgcggtgccgttcgactgcgcggcgctgctggacgacgtgacggaatcgtttcga
ccgcttgccgagcgcaagggcttgagcgtcatctgcgacgttgcgctggagccgtctcca
taccgcatcggcgatccgatccggattcggcagatcgtgtcgaacctgctgagcaacgcg
atcaagttcaccgacgccggtcatgtccgcgtggccgcgcatgcggcgtcggacgccgcg
cacggtaccggtcggacggccggcggcgcgcccgtcgtggagatcgtcgtcgcggatacc
ggcatcggcattcccgaagccgcgcaagcggcgatcttcggactgtatcggcaggcggac
gattcgattcatcggcgatacggcggcaccgggctcggcctcgcgctttgccgacgcctg
ctcgacgcaatgagcggagacatcgccgtgtcgagcgcgcccggtgcaggcagcacgttc
cgcgtgcggattccgctgccggtgtgcgacgacgagcgcggcgacgcgtcagccgaagtg
tcggatgtatcgcatgtcgcgatcgccggtacggggctcagcgtgctggtcgtcgaagat
catccggcgagccggctgctgttggccgaccagcttcgcgagctggacgtcgacgcgacg
ctcgtcgaatgcggtgccgacgcgctggccgcagtcgagcgagcgcgcttcgacatcgta
ctgaccgacctcgggctgcccgacatggacggctggtcgctggcgagcgaactgcgcgcg
cgcgatccggcgctccgtctgattgcgatgaccgcgcatgtcggctcggacgacgagcgt
cgctgtgccgacgccggcatccatgcgctgctgcgaaaaccgctgacgctgcgcaagctg
tcgcatgcgttgggtcgcgcggccgacacgcaggcgggcggccaccgaccgtcgagcggg
ctgccgcagacggttctgttcgcgatgcggcaggtcacccacgcgtcgattgcgtcgatc
gaccgcgcggtgacgaccggggacggcgataccgttcaacgtgagctgcattcgatgagc
ggcggtttcgtcgcggtgggccagcacgtgctcggcgagctctgttccggattgcagcag
gtcgtgcacgacgaggggctgcagggcttttcagtactttggccgtcgttgcgcgacgag
ataacgaatgcgatcgcggcgatctgcaaagtcgatgtgcgtgcgcgcgatgtgagcgtc
tag
DBGET
integrated database retrieval system