Brevundimonas diminuta: EQG53_14585 Help Entry EQG53_14585       CDS       T05851                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdm  Brevundimonas diminuta Pathway bdm01100   Metabolic pathways bdm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EQG53_14585    00074 Mycolic acid biosynthesis     EQG53_14585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EQG53_14585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 DUF7080 Motif Other DBs NCBI-ProteinID:  QAT15470 UniProt:  A0A246KMW6 LinkDB All DBs Position complement(2947431..2947670) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDVEIPDDAA EHIQTVGDAVKFIDEKLAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgaacgcgtccgcaagatcgtgatcgaccacctggacgccgatccg gacaaggtcaccgagaaggcttccttcatcgacgacctgggcgccgactcgctcgacaac gtcgaactggtcatggccttcgaagaagaattcgacgtcgaaatcccggatgacgccgca gagcacatccagaccgtcggcgacgcggtgaagttcatcgacgagaagctggccgcctga

DBGET integrated database retrieval system