Bdellovibrio sp. qaytius: CIK05_08355 Help Entry CIK05_08355       CDS       T05880                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdq  Bdellovibrio sp. qaytius Pathway bdq01100   Metabolic pathways bdq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIK05_08355 (acpP)    00074 Mycolic acid biosynthesis     CIK05_08355 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIK05_08355 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZZ38331 UniProt:  A0A3T0RWF1 LinkDB All DBs Position complement(1743409..1743645) Genome browser AA seq 78 aa AA seqDB search MAVQAKVKDIIVDQLGVDPEKVKLESKFIEDLGADSLDIVELVMAMEEEFDIEIPDEDAE KLKTVNDVQSYLVSKGKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagtacaagctaaagtaaaagatatcatcgttgatcaattaggcgtagaccctgaa aaagttaaacttgaatcaaaattcattgaagacttaggcgctgacagcttagatatcgtt gaattagttatggcgatggaagaagaattcgacatcgaaattccagatgaagacgctgaa aaattaaaaacagttaatgacgtacaaagctacctagtttctaaaggtaaagcgtag

DBGET integrated database retrieval system