Bdellovibrio sp. qaytius: CIK05_08755 Help Entry CIK05_08755       CDS       T05880                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bdq  Bdellovibrio sp. qaytius Brite KEGG Orthology (KO) [BR:bdq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bdq03032]     CIK05_08755    03036 Chromosome and associated proteins [BR:bdq03036]     CIK05_08755    03400 DNA repair and recombination proteins [BR:bdq03400]     CIK05_08755 DNA replication proteins [BR:bdq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CIK05_08755 Chromosome and associated proteins [BR:bdq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CIK05_08755 DNA repair and recombination proteins [BR:bdq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CIK05_08755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-CCDC81_bac_2 Synuclein ROS_MUCR DUF2267 Motif Other DBs NCBI-ProteinID:  AZZ36875 UniProt:  A0A3T0RRY9 LinkDB All DBs Position 1824120..1824404 Genome browser AA seq 94 aa AA seqDB search MNKAELVTAVSDKTKLSKSQVETMINTTLEVIQKTVSKGEEVKIVGFGSFQVQDRKAKTG RNPKTGETHKIPECSIPRFKPGKEFKTLVGKKKN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggcagagttagttacagcagtttcagataaaactaaactttcaaagtctcaa gttgagacaatgatcaacaccacattagaagttatccaaaaaactgtttctaaaggcgaa gaggtcaaaatcgtaggctttggttcgtttcaagttcaagatcgcaaagccaaaacggga cgcaatccaaaaacaggcgaaacgcacaaaatccctgagtgctcgatcccccgctttaaa cccggcaaagagttcaaaactcttgttggcaaaaagaagaattaa

DBGET integrated database retrieval system