Bdellovibrio sp. ZAP7: DOM22_06900 Help Entry DOM22_06900       CDS       T06441                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism bdz  Bdellovibrio sp. ZAP7 Brite KEGG Orthology (KO) [BR:bdz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bdz03110]     DOM22_06900 Chaperones and folding catalysts [BR:bdz03110]  Protein folding catalysts   Protein disulfide isomerase    DOM22_06900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_3 Glrx-like CLIC-like_N DUF7410 SH3BGR ZNRF_3_ecto Thioredoxin_2 Lar_restr_allev MurD-like_N Motif Other DBs NCBI-ProteinID:  QDK44908 UniProt:  A0A514XGN3 LinkDB All DBs Position 1385203..1385457 Genome browser AA seq 84 aa AA seqDB search MAKVLMYKKNPCPYCDRATTFMTNKGIDFEVIDLTDKPEEIDRIKNETGWRTVPIILING KLVGGYTDLKALDEEGKLDEMLKG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctaaagtgcttatgtataaaaagaatccatgcccttactgtgatcgcgcaacgact tttatgacgaataagggaatcgatttcgaagtgatcgacctcactgacaaacctgaagaa attgatcgcatcaaaaacgaaacaggttggagaacagtacccatcatcctgatcaacggc aaacttgttggtggctatacggatttgaaagctctcgatgaagagggcaagcttgatgaa atgttaaaaggctaa

DBGET integrated database retrieval system