Bdellovibrio sp. ZAP7: DOM22_10260 Help Entry DOM22_10260       CDS       T06441                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bdz  Bdellovibrio sp. ZAP7 Pathway bdz01100   Metabolic pathways bdz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DOM22_10260    00074 Mycolic acid biosynthesis     DOM22_10260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DOM22_10260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QDK45505 UniProt:  A0A514XIB0 LinkDB All DBs Position 2088127..2088363 Genome browser AA seq 78 aa AA seqDB search MALHPKVKDIIVEQLGVDPDKVKPEASFIDDLGADSLDIVELVMAMEEEFDLEIPDEDAE KLKTVQDVASYLEKKGKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcattgcatccaaaagttaaagacatcatcgtagaacaacttggcgtagatccagat aaagttaagcctgaggcttctttcatcgacgatcttggtgcagacagcttggacatcgtt gagctagtaatggctatggaagaagaattcgatcttgaaattccagacgaagatgctgaa aagcttaaaactgttcaagacgttgcttcttacctagaaaaaaaaggtaaagcgtag

DBGET integrated database retrieval system