Betaproteobacteria bacterium UKL13-2: AEM42_00450 Help Entry AEM42_00450       CDS       T04342                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism beb  Betaproteobacteria bacterium UKL13-2 Brite KEGG Orthology (KO) [BR:beb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:beb03036]     AEM42_00450 Chromosome and associated proteins [BR:beb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AEM42_00450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FPP Csm1_N ZapB CLZ CENP-F_leu_zip Lebercilin Apolipoprotein YabA DUF7603 DUF7653 Cep57_CLD_2 FlgK_D1 TelA GAS NET2A PRKG1_interact FlaC_arch Seryl_tRNA_N Nsp1_C DUF4763 DUF4164 CCDC138_cc Cnn_1N ACBP4_C DUF72 DUF4446 DUF1664 ATG14 SlyX Motif Other DBs NCBI-ProteinID:  AMS31248 UniProt:  A0A142LGA2 LinkDB All DBs Position 104048..104257 Genome browser AA seq 69 aa AA seqDB search MEADIQRFEEKLSHFVTLFQRLRSENNDLRQQLAAKGDEVKRLAEKLDQAKTRIEALVVQ LPETESDRT NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagccgatatccaacgctttgaggaaaagctcagccactttgttacgttattccag cgcttgcgctcggaaaacaatgacttgcgccagcagctcgccgccaagggggatgaagtg aagcggcttgccgaaaaactcgatcaggctaagacgcgtatcgaagcgctcgttgtgcaa ttgcccgaaaccgagagtgaccgcacatga

DBGET integrated database retrieval system