Betaproteobacteria bacterium UKL13-2: AEM42_07645 Help Entry AEM42_07645       CDS       T04342                                  Name (GenBank) hypothetical protein   KO K02437   glycine cleavage system H protein Organism beb  Betaproteobacteria bacterium UKL13-2 Pathway beb00260   Glycine, serine and threonine metabolism beb00630   Glyoxylate and dicarboxylate metabolism beb00670   One carbon pool by folate beb00785   Lipoic acid metabolism beb01100   Metabolic pathways beb01110   Biosynthesis of secondary metabolites beb01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:beb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     AEM42_07645   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     AEM42_07645   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     AEM42_07645    00670 One carbon pool by folate     AEM42_07645 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H Biotin_lipoyl ATP-synt_ab_Xtn Motif Other DBs NCBI-ProteinID:  AMS32303 LinkDB All DBs Position 1697098..1697481 Genome browser AA seq 127 aa AA seqDB search MNIPANLKYTKSHEWIRLEADGTLTIGITDPAQEMLGDLVFVGDVKVGQTLSAGDTAGVV ESVKAASDIYAPVNGEVTEFNGELDAAPEALNGAPYDNWIFKMKPANVEDLAKLLDAAAY QTVATAG NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaacatcccagctaatctcaaatacaccaaaagccacgaatggatccgcttggaggcc gacggcacgctcactattggcattaccgatcctgcccaagagatgttgggcgatttggtg tttgtcggcgatgtcaaggtggggcagaccctgagtgcgggtgacaccgcaggcgtggtc gagtcagtgaaagcggcatccgacatttatgcgccggtcaacggtgaagtcaccgaattc aatggcgagcttgacgccgcaccggaggcacttaacggcgcgccgtacgacaattggatt ttcaaaatgaaacccgccaatgtagaagacctcgccaagctgctcgatgcagccgcctat caaacggttgccaccgctggttaa

DBGET integrated database retrieval system