Barrientosiimonas endolithica: GCM100_25540 Help Entry GCM100_25540      CDS       T09132                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bei  Barrientosiimonas endolithica Pathway bei01100   Metabolic pathways bei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GCM100_25540    00074 Mycolic acid biosynthesis     GCM100_25540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GCM100_25540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDZ58897 UniProt:  A0ABN6YN91 LinkDB All DBs Position complement(2437832..2438083) Genome browser AA seq 83 aa AA seqDB search MSTLSRDQVREMMAEVLSAQGKQLPAEDSASLQEIGFRSLDFSELALRVEDEIDTELNFD APGLRSIETVGDVLDFLDQLQNA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcacgctcagccgggaccaggtgcgcgagatgatggccgaggtgctctcggcccag ggcaagcagctgcccgccgaggactccgcgtcgttgcaggagatcggcttccgctcgctg gacttctccgagctggcgctgcgcgtcgaggacgagatcgacaccgagctcaacttcgac gcccccggcctgcgctccatcgagaccgtcggcgacgtgctcgacttcctcgaccagctg cagaacgcgtga

DBGET integrated database retrieval system