Bradyrhizobium elkanii: BE61_02250 Help Entry BE61_02250        CDS       T07520                                  Name (GenBank) HNS-type DNA binding protein   KO K03530   DNA-binding protein HU-beta Organism bel  Bradyrhizobium elkanii Brite KEGG Orthology (KO) [BR:bel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bel03032]     BE61_02250    03036 Chromosome and associated proteins [BR:bel03036]     BE61_02250    03400 DNA repair and recombination proteins [BR:bel03400]     BE61_02250 DNA replication proteins [BR:bel03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BE61_02250 Chromosome and associated proteins [BR:bel03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BE61_02250 DNA repair and recombination proteins [BR:bel03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BE61_02250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 PqqD Motif Other DBs NCBI-ProteinID:  BBB94815 LinkDB All DBs Position 215196..215474 Genome browser AA seq 92 aa AA seqDB search MTTAAEIADEIAKAYNLPKAQAKSIVDGVFKSIADAAASDAETNVPGFGKFKVKHTPERE GRNPSTGAAIKIAAAKKLTFAPAKALKDALNG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccaccgccgctgaaatcgccgacgagatcgccaaggcgtacaacctgccaaaggca caagccaagtctatcgtggacggtgtcttcaagtctatcgccgatgcagcggcgagcgac gctgaaaccaatgtgccgggctttggcaagttcaaggtgaagcacaccccggagcgcgaa ggccgcaatccctcgactggcgcggcgatcaagatcgcggcggcgaagaagctgacgttc gccccggccaaggccctcaaggatgcgctgaacggctaa

DBGET integrated database retrieval system