KEGG   Priestia filamentosa: BEH_03780
Entry
BEH_03780         CDS       T03983                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
beo  Priestia filamentosa
Brite
KEGG Orthology (KO) [BR:beo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:beo03000]
    BEH_03780
Transcription factors [BR:beo03000]
 Prokaryotic type
  Other transcription factors
   Others
    BEH_03780
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: AKO91305
UniProt: A0A0H4KCG9
LinkDB
Position
756659..757615
AA seq 318 aa
MNNKKKGLGLLCLLFLLLTGCDNKPHKIEKVGLLIPSTVNDQVWGTKGYTGLVGIQSEFG
VDIFYKEKIDSESVIEEAVEEFHKRGVNLVFGHGDIYTPVFNKLGKKYPDMHFVGFNGDA
KEDNVTSLNFSAYAMGFFGGMVAGKMTETNQVGIIAAYAWQPEVKGFADGAAFQNKKVNV
DIRYVHSWDDVQAASHILNNMLQKNVDVVYPAGDGYNVPLIEELKERNLYSIGFISDQSH
FGGNTVLTSTVQDVAHLYVVAAEKFDKGELQSGNAYFDFQDGVVSMGEFSQNIDESFREK
IQRDIETYQKTGKLPNEK
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaataacaagaagaaaggtttagggcttctatgccttctttttttgcttttaacaggg
tgtgacaataagccacataaaatcgaaaaagtgggtttgcttatcccaagtactgtgaat
gatcaagtatgggggacgaaaggttatacaggacttgtgggtattcaatctgagtttggt
gttgatattttttataaagaaaaaatagattcagagagtgtcatagaagaagcggtagaa
gaatttcataaaagaggcgtcaatttagtctttggacatggtgatatttatacgcctgtc
tttaataagcttggaaaaaagtatcctgatatgcattttgtagggtttaatggagatgca
aaagaggataatgtaacaagtttgaattttagcgcttatgctatgggtttttttggtggc
atggtagcgggaaagatgacggagacaaatcaagtaggaatcattgccgcgtacgcatgg
cagccagaggtaaaagggtttgctgatggagctgcttttcagaataagaaagtaaatgtt
gatattcgctatgttcatagctgggacgatgtgcaagcagcatcgcatattcttaacaat
atgcttcaaaaaaatgttgatgttgtatatccagcaggggatggctataatgttccactt
attgaagaattgaaagaaagaaacctttattcaattggatttatctctgatcagagccat
tttggtggaaatacggtattaacaagtactgttcaggatgttgctcatctttatgttgtc
gcagctgagaagtttgataaaggcgagctgcagtcagggaatgcttactttgatttccaa
gatggagttgtttcaatgggggaatttagtcagaatatagatgagtcgtttcgagaaaaa
atacagcgagatattgaaacttatcaaaagacaggaaagttaccaaatgaaaagtag

DBGET integrated database retrieval system