Priestia filamentosa: BEH_24600 Help Entry BEH_24600         CDS       T03983                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism beo  Priestia filamentosa Brite KEGG Orthology (KO) [BR:beo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:beo03032]     BEH_24600    03036 Chromosome and associated proteins [BR:beo03036]     BEH_24600    03400 DNA repair and recombination proteins [BR:beo03400]     BEH_24600 DNA replication proteins [BR:beo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BEH_24600 Chromosome and associated proteins [BR:beo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BEH_24600 DNA repair and recombination proteins [BR:beo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BEH_24600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Ribosomal_L12 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AWG44882 UniProt:  A0A2L1FFL8 LinkDB All DBs Position pBEH1:19094..19366 Genome browser AA seq 90 aa AA seqDB search MNKTELIKNVAIKTGLTQKDSTKALEGLFKTISDTLSKEEKIRLVGFGSFEVRERSGRTG RNPQTGEEIKLPATKVPAFKPGKELREAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaactcattaagaatgtcgccataaaaacaggattaacgcagaaggat tcaacaaaagctttggaagggttatttaaaacgatttctgataccttgtctaaggaggag aaaattcgactagtggggtttggatcgtttgaagttcgagagcgttcgggtcgaacaggc cgtaatccacaaacaggtgaagagataaaacttccggctactaaagtgccagcttttaaa cctggtaaggagttaagagaagctgtgaaatag

DBGET integrated database retrieval system