Theileria equi: BEWA_053480 Help Entry BEWA_053480       CDS       T02820                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism beq  Theileria equi Pathway beq03022   Basal transcription factors beq03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:beq00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     BEWA_053480   09124 Replication and repair    03420 Nucleotide excision repair     BEWA_053480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:beq03021]     BEWA_053480    03400 DNA repair and recombination proteins [BR:beq03400]     BEWA_053480 Transcription machinery [BR:beq03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      BEWA_053480 DNA repair and recombination proteins [BR:beq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      BEWA_053480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 APD1-4_N Motif Other DBs NCBI-GeneID:  15802900 NCBI-ProteinID:  XP_004832745 UniProt:  L1LDB5 LinkDB All DBs Position 4 Genome browser AA seq 67 aa AA seqDB search MYVFLFTFIFSDPPTMEIVKQINETKHFIIEQIDEGVALCNDDVHGFLKGSIKMTIITCM RWIYWWN NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgtacgttttcctcttcacattcatatttagcgacccaccgacgatggagattgtcaag caaataaacgagacaaaacactttataatcgaacaaatagacgagggagttgcactctgt aacgacgatgttcacggatttttaaagggtagtataaagatgacgataataacctgtatg aggtggatatactggtggaattag

DBGET integrated database retrieval system