Pseudobdellovibrio exovorus: A11Q_1323 Help Entry A11Q_1323         CDS       T02492                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bex  Pseudobdellovibrio exovorus Pathway bex01100   Metabolic pathways bex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A11Q_1323    00074 Mycolic acid biosynthesis     A11Q_1323   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A11Q_1323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AGH95539 UniProt:  M4VQW1 LinkDB All DBs Position 1345531..1345767 Genome browser AA seq 78 aa AA seqDB search MSINTKVKDIIVEQLGVDPEKVKAEASFIDDLGADSLDIVELVMAMEEEFDLEIPDEDAE KLKTVNDVQSYLSSKGKV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaatcaacacaaaagtaaaagatattatcgttgaacaacttggagtagacccagag aaagtaaaagcagaagcatcttttatcgatgatttaggcgctgacagtcttgatatcgtt gaattagttatggctatggaagaggaatttgacttagaaattcctgatgaagatgctgaa aaactaaaaactgtaaacgatgttcaatcttacttgagctcaaaaggaaaagtttag

DBGET integrated database retrieval system