KEGG   Pseudobdellovibrio exovorus: A11Q_2379
Entry
A11Q_2379         CDS       T02492                                 
Name
(GenBank) chemotaxis response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bex  Pseudobdellovibrio exovorus
Pathway
bex02020  Two-component system
bex02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A11Q_2379
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    A11Q_2379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bex02022]
    A11Q_2379
   02035 Bacterial motility proteins [BR:bex02035]
    A11Q_2379
Two-component system [BR:bex02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   A11Q_2379
Bacterial motility proteins [BR:bex02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    A11Q_2379
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AGH96595
UniProt: M4VDN3
LinkDB
Position
complement(2427938..2428327)
AA seq 129 aa
MSIKCLVVEEAAFIRQIYRLNLHGVNGVEIVAEARDGVEALRLISEIQPDMVLLELVLPL
KSGLDVLKSLHGVSPRTQVIVISSLDDESLRVQAKALGAHAYLTKPFTRSQLLGAVEEIC
QHYAGVQNG
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagtattaaatgtttggttgttgaagaagccgcctttatccgacaaatttatcgtctt
aatttgcatggagtaaatggtgtcgagatcgtggcagaagcacgtgatggtgtggaagct
ctacgattgatttcagagattcagccagacatggttttgctagaacttgttctgccttta
aaaagcggccttgatgttttgaaatccctccatggcgtttcaccaagaacacaagtcatc
gtgatctcatcgttagatgacgagtctcttcgtgttcaggcaaaggctttgggggcccat
gcgtatttaacaaagccatttactcgctcgcaattacttggtgctgtagaggaaatctgc
cagcactacgccggagtccaaaatggatga

DBGET integrated database retrieval system