Bacteroides fragilis BOB25: VU15_00440 Help Entry VU15_00440        CDS       T03897                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfb  Bacteroides fragilis BOB25 Pathway bfb01100   Metabolic pathways bfb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VU15_00440    00074 Mycolic acid biosynthesis     VU15_00440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VU15_00440 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  AKA50331 UniProt:  A0A081UGL3 LinkDB All DBs Position complement(108943..109179) Genome browser AA seq 78 aa AA seqDB search MSEIASRVKAIIVDKLGVEESEVTETASFTNDLGADSLDTVELIMEFEKEFGISIPDDQA EKIGTVQDAVAYIEEHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgcatcaagagtgaaagcgattatcgtcgataaattgggcgtagaagaa tcagaagttacagaaacagcaagcttcactaacgacctgggagctgattctcttgacact gtagaacttatcatggaattcgaaaaagaattcggtatctctatccctgatgaccaagct gaaaagattggcacagtacaggatgctgtagcttacatcgaagaacacgctaagtaa

DBGET integrated database retrieval system