Bacteroides fragilis BOB25: VU15_06435 Help Entry VU15_06435        CDS       T03897                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfb  Bacteroides fragilis BOB25 Pathway bfb01100   Metabolic pathways bfb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VU15_06435    00074 Mycolic acid biosynthesis     VU15_06435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VU15_06435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKA51377 UniProt:  A0ABD5FS08 LinkDB All DBs Position 1634030..1634272 Genome browser AA seq 80 aa AA seqDB search MDRKIIMEKIQDIFRDVFDDEELVVEDSTSSDDIEEWDSLSHIQLVVAVEKTFGLKLTSK EILSWEDVGEMADAIYAKLA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatagaaaaatcataatggaaaagatacaagatatcttccgtgatgtatttgatgac gaagaactagtagtagaagattcaacgtcttctgatgatattgaagagtgggactcgcta tcacatattcagttagtagtggctgtagaaaagacctttggactaaaattaacatccaaa gaaattctttcatgggaagatgtaggtgaaatggcggacgctatatatgcgaagcttgct taa

DBGET integrated database retrieval system