Bacteroides faecium: BacF7301_09540 Help Entry BacF7301_09540    CDS       T08751                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfc  Bacteroides faecium Pathway bfc01100   Metabolic pathways bfc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BacF7301_09540    00074 Mycolic acid biosynthesis     BacF7301_09540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BacF7301_09540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF4438_C Motif Other DBs NCBI-ProteinID:  QIU94374 UniProt:  A0A6H0KLQ1 LinkDB All DBs Position complement(2669444..2669695) Genome browser AA seq 83 aa AA seqDB search MTNEEIIEKIRTTLAEEFEVDIDIIQPDAPLMETLELDSLDLVDMVVLVEKNFGFNVTGQ DFAGIKTFQDFYNLVITRMQEAK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacaaacgaagaaatcatcgagaaaataagaaccactctggcagaagagtttgaagta gacatcgacatcatccagccggatgcgccgttaatggagactctcgaactggacagcctg gacttggtcgacatggtggtgctggtagaaaagaatttcgggtttaacgtgaccggacag gattttgcaggtatcaagacctttcaggacttctacaatcttgttattacccgcatgcag gaagctaaataa

DBGET integrated database retrieval system