Bacteroides faecium: BacF7301_18100 Help Entry BacF7301_18100    CDS       T08751                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bfc  Bacteroides faecium Brite KEGG Orthology (KO) [BR:bfc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bfc03032]     BacF7301_18100    03036 Chromosome and associated proteins [BR:bfc03036]     BacF7301_18100    03400 DNA repair and recombination proteins [BR:bfc03400]     BacF7301_18100 DNA replication proteins [BR:bfc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BacF7301_18100 Chromosome and associated proteins [BR:bfc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BacF7301_18100 DNA repair and recombination proteins [BR:bfc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BacF7301_18100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF5601 HU-CCDC81_bac_2 DUF5915 PNGase_A_C Motif Other DBs NCBI-ProteinID:  QIU95945 UniProt:  A0A6H0KRM8 LinkDB All DBs Position 4903692..4903964 Genome browser AA seq 90 aa AA seqDB search MNNKEFTSELAERLGYTIKDTSELISSLLSSMTQELEEGNMIAVQGFGSFEVKKKAERIS INPASKQRMLVPPKLVLSYRPSNTLKDKFK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataataaggaatttacatctgaactggcagaaagattgggatataccatcaaagat acttccgaattaataagctctttgctgtccagcatgacgcaagaactggaggaaggtaat atgattgcggtccagggatttggttctttcgaagtaaagaagaaagcggagcgcatttct ataaatccggcgagtaaacagcgtatgctggttcctcccaaattggtattatcttataga cctagcaatacactgaaagataagtttaaataa

DBGET integrated database retrieval system