Bacillus freudenreichii: NCTC4823_02514 Help Entry NCTC4823_02514    CDS       T06767                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfd  Bacillus freudenreichii Pathway bfd01100   Metabolic pathways bfd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC4823_02514 (acpP)    00074 Mycolic acid biosynthesis     NCTC4823_02514 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC4823_02514 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  VEF48436 LinkDB All DBs Position 1:complement(2559065..2559298) Genome browser AA seq 77 aa AA seqDB search MADVQERVTKIIVDRLGVEESKVEMESSFRDDLGADSLDVVELVMELEDEFDMEISDEDA EKIATVGDAVNYIKSNS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgtacaagaaagagtgactaaaattattgtagaccgccttggagtggaagag tctaaagttgaaatggaatcttctttcagagacgatctaggagctgactcacttgacgtt gttgagcttgtcatggaattagaagatgagtttgatatggaaatttccgatgaggatgct gaaaagattgcaacagtcggtgatgcggtcaattacataaaaagcaatagctag

DBGET integrated database retrieval system