Bacteroides faecis: K6V30_14630 Help Entry K6V30_14630       CDS       T07899                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bfe  Bacteroides faecis Pathway bfe00020   Citrate cycle (TCA cycle) bfe00720   Other carbon fixation pathways bfe01100   Metabolic pathways bfe01110   Biosynthesis of secondary metabolites bfe01120   Microbial metabolism in diverse environments bfe01200   Carbon metabolism bfe01210   2-Oxocarboxylic acid metabolism Module bfe_M00009   Citrate cycle (TCA cycle, Krebs cycle) bfe_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:bfe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K6V30_14630   09102 Energy metabolism    00720 Other carbon fixation pathways     K6V30_14630 Enzymes [BR:bfe01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K6V30_14630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 LdpA_Fe-S-bd Fer4_4 Fer4_9 Fer4_16 Fer4_15 Fer4_22 Fer4_8 Fer4_17 Fer4_13 Fer4_3 DUF2284 Motif Other DBs NCBI-ProteinID:  UBE43491 LinkDB All DBs Position complement(3769679..3769906) Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLDVIALNKEVNMKGYNYAWQVKEDTCNGCSSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaattaaaggagcaatcgtagtcgacacggagcgttgcaaagggtgtaacctg tgtgtagtagcgtgtccgctcgatgtaatcgccctcaataaagaggtaaatatgaaaggc tataactatgcctggcaagtaaaagaagatacctgtaacggatgtagctcgtgcgcaaca gtttgtcccgacggatgtatctcagtgtataaagtaaaagtagaataa

DBGET integrated database retrieval system