Candidatus Blochmanniella floridana: Bfl403 Help Entry Bfl403            CDS       T00138                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bfl  Candidatus Blochmanniella floridana Pathway bfl01100   Metabolic pathways bfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bfl403 (acpP)    00074 Mycolic acid biosynthesis     Bfl403 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bfl403 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CAD83469 UniProt:  Q7VR21 LinkDB All DBs Position complement(444567..444803) Genome browser AA seq 78 aa AA seqDB search MSIVEEKVKTIIAEQLGVKQEEVVNHASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDFIHTNQK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcattgttgaagaaaaagtaaaaactattattgctgaacaattaggagtaaaacag gaagaagtagtaaatcatgcttcgtttgttgatgatttaggagctgattctcttgatact gttgaattagttatggcattagaggaagagtttgatattgaaatcccagatgaagaggca gaaaaaattactactgttcaagcagctatagatttcattcatactaatcagaaatag

DBGET integrated database retrieval system