Brevibacillus formosus: BP422_05355 Help Entry BP422_05355       CDS       T04939                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bfm  Brevibacillus formosus Pathway bfm00975   Biosynthesis of various siderophores bfm01100   Metabolic pathways bfm01110   Biosynthesis of secondary metabolites Module bfm_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bfm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BP422_05355  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bfm01008]     BP422_05355 Polyketide biosynthesis proteins [BR:bfm01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BP422_05355 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding SYN8_N Motif Other DBs NCBI-ProteinID:  ASJ53031 LinkDB All DBs Position 1107849..1108115 Genome browser AA seq 88 aa AA seqDB search MTRTERIEQIHTIMTEKLKLSHILTLEESMRLNEDLHIDSIMLLQLIVYIEEDLKLIVPA HELDPRIFQTVESLLTFVEQLEPQHVSN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacacgaacagaaagaatcgagcaaatccatacgatcatgaccgaaaaattaaaatta tcgcatatcctcacgctagaggagtccatgcgattgaatgaggatctacatattgattcg attatgctattgcaactgattgtttatatcgaggaagatttgaaattgatcgtacctgct catgagttagatccacgcatcttccaaacggttgaatcactgcttacttttgttgaacag ctggaaccgcagcatgtatcgaattag

DBGET integrated database retrieval system